This is a working overview of regulatory status, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-02-08. Anything still debated is marked as such rather than presented as settled.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2, also written Melanotan II, is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone. Its sequence is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, and the lactam bridge between the aspartate and lysine side chains constrains the peptide into a ring. This structural change increases receptor affinity and metabolic stability relative to the native hormone. The compound was created in the 1980s as a research tool for studying pigmentation biology.
Melanocytes are the pigment-producing cells of the skin, and they carry melanocortin-1 receptors on their surface. When the receptor is activated, cyclic adenosine monophosphate rises inside the cell and raises the activity of enzymes such as tyrosinase, which increases melanin output. Melanotan-2 binds melanocortin-1 receptors in vitro and in animal models, and this binding is generally described as the basis for the tanning effect. Other receptors account for different effects: melanocortin-4 receptors contribute to appetite and erectile signalling, while melanocortin-3 and melanocortin-5 receptors contribute to energy balance and exocrine function.
Early published reports described melanotan-2 as a tanning agent without sun protection, which means darkening is not the same as protection against ultraviolet radiation. Later studies explored the peptide in erectile dysfunction, hemorrhagic shock, and some skin conditions. No regulator in the United States or Europe has approved it for clinical use. Many products labelled melanotan-2 are sold without approval and their identity and purity are unverified. Its long-term safety in humans remains an open question.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved for therapeutic use | No marketing authorisation from major agencies |
| Legal classification | Varies by jurisdiction | Prescription-only or controlled in several countries |
| Common synonyms | Melanotan II; MT-II | Also referenced by catalogue codes |
| Typical analytical method | Reverse-phase HPLC | Often paired with mass spectrometry |
| Primary literature focus | Receptor pharmacology | Pigmentation and melanocortin signalling |
Identity and purity are assessed with chromatographic and mass spectrometric techniques. Reversed-phase high-performance liquid chromatography separates the target peptide from related impurities and degradation products, and the resulting retention time is compared against a reference standard. Mass spectrometry, often coupled to liquid chromatography, confirms molecular mass. Amino acid analysis or peptide mapping can provide additional sequence-level confirmation when required. Results are only as reliable as the reference materials used alongside them.
Regulatory treatment varies by country. In the United States, melanotan-2 is not approved for any indication, and products marketed for human use fall outside the approved drug framework. Some other jurisdictions have placed it under prescription controls or listed it as a prohibited or restricted substance. Online listings frequently describe the material as a research chemical, a category that does not carry the same manufacturing and labelling requirements as approved medicines.
Solid peptide material is generally stable when kept cold and dry. Common practice is storage at -20 degrees Celsius or lower, with desiccant and protection from light. Repeated freeze-thaw cycles and exposure to moisture are associated with degradation, aggregation, or loss of material. Once dissolved, stability depends on solvent, concentration, and temperature, and solutions are usually treated as short-lived unless stability data support longer periods. Handling notes typically emphasise minimising time at ambient temperature.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Dr. Stone is an anime television series produced by TMS Entertainment based on the manga series of the same name written by Riichiro Inagaki and illustrated by Boichi. Set 3,700 years after a mysterious light turns every human on the planet into stone, genius boy Senku Ishigami emerges from his petrification into a "Stone World" and seeks to rebuild human civilization from the ground up. Dr. Stone's second season, titled Dr. Stone: Stone Wars, aired from January 14 to March 25, 2021. The season premiered on Tokyo MX and KBS in a dual simulcast, with other networks following at later timeslots. It focuses on the story of the "Stone Wars" arc from the manga, in which Senku and the Ishigami villagers of the Kingdom of Science go to war with Tsukusa's Kingdom of Strength. The season is streamed by Crunchyroll worldwide outside of Asia, while then-separate company Funimation produced a simuldub. The season ran for 11 episodes. A sequel was announced after second season finale. The English dub for Stone Wars aired on Adult Swim's Toonami programming block from May 16 to July 25, 2021. The opening theme song is "Rakuen" (楽園; lit. 'Paradise') performed by Fujifabric, while the ending theme song is "Koe?" (声?; lit. 'Voice?') performed by Hatena.
== Clinical implications == Disposition index is used as a measure of beta cell function and the ability of the body to dispose of a glucose load. Thus a lowering of disposition index predicts the conversion of insulin resistance to diabetes mellitus type 2. Disposition index, but not insulin resistance, can predict type 2 diabetes in persons with normal blood glucose levels, but who do not have a family history (genetic predisposition) to type 2 diabetes. Disposition index can be increased by aerobic exercise, but only to the extent that insulin sensitivity is improved. The static disposition index (SPINA-DI) declines with increasing adherence to mediterranean diet. This may result from increased use of other macronutrients for the provision of energy and a reduction in the chronic stimulus for dynamical compensation with consecutive insulin hypersecretion. The disposition index is reduced in several chronic conditions including cystic fibrosis, reduced PCSK9 expression and inflammatory diseases, e.g. hidradenitis suppurativa (acne inversa).
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Sources: en.wikipedia.org
=== Reactant recycling === Because the urea conversion is incomplete, the urea must be separated from the unconverted reactants, including the ammonium carbamate. Various commercial urea processes are characterized by the conditions under which urea forms and the way that unconverted reactants are further processed.
Psilocybin, also known as 4-phosphoryloxy-N,N-dimethyltryptamine (4-PO-DMT), is a naturally occurring tryptamine alkaloid and investigational drug found in more than 200 species of mushrooms, with hallucinogenic and serotonergic effects. Effects include euphoria, changes in perception, a distorted sense of time, and perceived spiritual experiences. Psilocin is the metabolite of psilocybin. The compound psilocybin itself is biologically inactive but quickly converted by the body to psilocin. Psilocybin is transformed into psilocin by dephosphorylation mediated via phosphatase enzymes. Psilocin is chemically related to the neurotransmitter serotonin and acts as a non-selective agonist of the serotonin receptors. Activation of one serotonin receptor, the serotonin 5-HT2A receptor, is specifically responsible for the hallucinogenic effects of psilocin and other serotonergic psychedelics. Psilocybin is usually taken orally. By this route, its onset is about 20 to 50 minutes, peak effects occur in about 1 to 2 hours, and its duration is about 4 to 6 hours. Psilocybin mushrooms were used ritualistically in pre-Columbian Mexico, but claims of their widespread ancient use are largely exaggerated and shaped by modern idealization and ideology. In 1958, the Swiss chemist Albert Hofmann isolated psilocybin and psilocin from the mushroom Psilocybe mexicana. His employer, Sandoz, marketed and sold pure psilocybin to physicians and clinicians worldwide for use in psychedelic therapy.
Workplace exposure can be at a high concentration for the duration of a shift, and thus short-term, whereas exposure outside of work is at low concentration and long-term. For instance, the concentration of worker exposure from extrusion 3D printers is orders of magnitude higher than the general population (e.g., 4×1010 particles per cubic meter [m3] versus 50 particles per m3 in the general environment). The main route of workplace exposure is acute inhalation. Plastics are extensively used in the construction and renovation industry. Airborne microplastic dust is produced during renovation, building, bridge and road reconstruction. High chronic exposure to aerosolized MNPs also occurs in the synthetic textile industry, the flocking industry, and the plastics industry, especially in vinyl chloride and polyvinyl chloride (PVC) manufacturers. In manufacturing, there is risk of exposure to both intentionally and incidentally generated MNPs. For instance, MNPs are intentionally generated during 3D printing but can also be incidentally generated due to mechanical or environmental degradation, or through industrial processes such as plastic manufacturing (heating and chemical condensation).
== MHC class II and Type I diabetes == MHC class II genes and molecules are related to a multitude of different diseases, one of which being Type I diabetes. HLA class II genes are the most important genes associated with the risk of inheriting Type I diabetes, accounting for about 40-50% of heritability. Alleles of these genes that affect peptide binding to the MHC class II molecules seem to impact Type I diabetes risk the most. Specific allele polymorphisms have been identified to increase the risk (such as DRB1 and DQB1). Others have been associated with a resistance to the disease.
Sources: en.wikipedia.org
Major regulatory agencies have not approved it for any indication. Some countries permit it only under prescription frameworks, while others classify it as a controlled substance.
Much of the evidence comes from case reports and accounts of unregulated use rather than controlled trials. Differences in product purity and dosing add further variability.
Laboratory work focuses on receptor binding and cellular signalling. Observational reports document outcomes after use, and analytical chemists examine samples to assess content and purity.
No. It is a laboratory-made peptide, while the natural hormone is alpha-melanocyte-stimulating hormone, a longer peptide produced by the pituitary gland and by skin cells. Melanotan-2 mimics only a short active region of that hormone and contains non-natural residues such as D-phenylalanine.